DPCstruct | MC2475
Metacluster Properties and Pfam Annotations
| Number of structural domains | 94 |
|---|---|
| Mean domain length (aa) | 184 ± 34 aa |
| Standard deviation of domain lengths | 34.45 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 84.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 24.09 |
| Pfam Score | 57.98 |
| Assigned Pfam label(s) | PF00460- PF06429- PF07559 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E6PCM2 | 3-181 | GIQWAAEAMAAAQQRLDIATSNLANASSDAFQRLRARGTIDRSGVRIRAVADTRPGALRPTGRPFDLAVSGGALQLRDARGATVRLT… |
| A0A257TTB5 | 96-293 | ATKILTEAVTALKTKLAVIGHNMANADTIGFKRSRVMFEDGRYRQVKLPGASDAFNNYAPTGLAIGLGVRVQATQILFDQGPIQVTN… |
| H6SME5 | 131-340 | None |
| A0A7X8E524 | 1-142 | None |
| A0A7V3ABZ5 | 52-250 | None |
| A0A1H4LLG9 | 160-315 | None |
| M6VAQ7 | 25-246 | None |
| A0A7X2PKL4 | 1-142 | None |
| A0A656GZX5 | 1-112 | None |
| A0A523FEA3 | 3-209 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.