DPCstruct | MC24749
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 108 ± 15 aa |
| Standard deviation of domain lengths | 14.87 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 88.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 15.45 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15569 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X8HSH7 | 146-274 | YRLPKKIRERAIESGNEFGWKQQDFKNVVEAARQVPMAVVGGQVQYVFNDGICELYWLSYDPDERQENEDWIAYCNRTANQVNQKFD… |
| A0A4R8L928 | 76-181 | EIYKHYLARAVTADGGETYLHAYDAPNFIADCETWNIAILGFDTFWIDETGILPFLDGIADFSPREKEPWAEYRSTCNRLSAEIVNQ… |
| A0A7C9L511 | 2-101 | None |
| A0A1R1IGZ8 | 1-99 | None |
| A0A7V7MMY8 | 6-94 | None |
| A0A6N7LBM9 | 5-81 | None |
| A0A1N6KQP2 | 4-111 | None |
| A0A7C1IJB0 | 6-120 | None |
| A0A1V2SLI8 | 1-99 | None |
| A0A495YWU5 | 8-135 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.