DPCstruct | MC24748
Metacluster Properties and Pfam Annotations
| Number of structural domains | 234 |
|---|---|
| Mean domain length (aa) | 127 ± 25 aa |
| Standard deviation of domain lengths | 24.71 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 88.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 25.99 |
| Pfam Score | 97.94 |
| Assigned Pfam label(s) | PF00082- CL0193- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A090X4J0 | 1-94 | MAPMTRSRANNEGKVATDELQGLYYEQRASAGLIISEGSQVSEQAVGYINTPGIHTDAQVEGWKKVTKRVHDKGGKIFIQLWHVGRM… |
| C7IVE6 | 62-171 | MLLKEGKIGKIKLKNRLIMLPTVTNLSNEGFVSEREVEYYKRRSKGVSLVIVGASYVNKLGKFFVNQIGIDDDDKIEGLRKLSEVIH… |
| A0A4S2MNH3 | 129-263 | None |
| A0A2N9IDA7 | 365-512 | None |
| A0A6A6L922 | 1-106 | None |
| A0A6P8BPT4 | 109-242 | None |
| A0A5N6EQQ3 | 173-323 | None |
| A0A068UQF0 | 2-82 | None |
| A0A0B8PFG3 | 5-137 | None |
| A0A084RSA1 | 804-986 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.