DPCstruct | MC24747
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 107 ± 10 aa |
| Standard deviation of domain lengths | 10.00 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 93.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 53.24 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04608 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A559IID0 | 66-170 | KREVQNAILTGIQLDMMAEEGKLIPVLQEMVENDEGLYGVDEILAFSIVNVYGSIGFTNFGYVDKMKAGVLERLNDKSDGQIHTFLD… |
| C7ITF3 | 1-97 | MTGITLDKLAEKDMLEEPLLSILKKDEPLYGIDEILALSITNVYGSIGLTNFGYLDKVKPGIIGKLNEDKEKKCNTFIDDLVAAIIA… |
| A0A401FMC3 | 3-108 | None |
| A0A2A8TKZ5 | 53-160 | None |
| A0A244CA89 | 62-162 | None |
| A0A1V4FJC4 | 62-166 | None |
| A0A7T5M7X0 | 58-162 | None |
| A0A1I6RLW0 | 49-173 | None |
| A0A1G5IAB3 | 117-227 | None |
| A0A4V1AJ24 | 78-207 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.