DPCstruct | MC24742
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 47 ± 1 aa |
| Standard deviation of domain lengths | 0.70 |
| Length coefficient of variation | 0.01 |
| Mean AlphaFold2 pLDDT confidence score | 77.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.53 |
| Mean length-normalized TM-Score | 0.96 |
| Mean intra-cluster local Distance Difference Test score | 0.95 |
| Mean intra-cluster sequence similarity (%) | 70.74 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15526 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G3TLU5 | 41-87 | GQEVFFNGKNYITPDVDGHNVSDGWKMFNKKGQRIGTYDADLNYIKK |
| A0A7X5KD78 | 98-144 | GQPVFFDGKTYITPDVDSHNVTNGWKMFDRRGKRMGTYDSDLNRVKD |
| A0A1I1TKF8 | 203-249 | None |
| A0A0T9RSU1 | 153-199 | None |
| A0A377LUH6 | 143-189 | None |
| A0A810ZPA9 | 198-242 | None |
| A0A1S8Y4D7 | 146-192 | None |
| A0A658A589 | 240-286 | None |
| A0A1V3ISV8 | 608-654 | None |
| A0A828GPA5 | 1-48 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.