DPCstruct | MC24740
Metacluster Properties and Pfam Annotations
| Number of structural domains | 60 |
|---|---|
| Mean domain length (aa) | 87 ± 12 aa |
| Standard deviation of domain lengths | 12.18 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 85.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 38.41 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A554LQX8 | 2-60 | VELTTEEAEALRLKNIKNLEQIECAEQMKTSQSTFQRILSSAYKKISDALINGKAIKII |
| Q2FSU1 | 7-96 | LRCYGPRCEVLGEIEAVVLLPEEIEVIRLIDLEGMEQEEAASFLGVSRRTVWKDLHDARRKVADALVHGKMIEVAGCVRQGGNECPK… |
| F0YW26 | 40-129 | None |
| A0A1C6E4G8 | 1-70 | None |
| A0A843GB63 | 3-66 | None |
| A0A1J4WGW8 | 1-74 | None |
| A0A662QS05 | 7-77 | None |
| A0A7C3UY53 | 20-113 | None |
| A0A850MD91 | 2-94 | None |
| A0A3C0ZS44 | 2-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.