DPCstruct | MC2474
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 223 ± 28 aa |
| Standard deviation of domain lengths | 27.62 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 20.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F9V9P2 | 290-462 | WAHEDELMVERPYAYRYRLVLVNPLLASAVDVDDAHRQDAATPLAFSGWSPWSDSAAAAPVTEFFMRSASSQGFVRVEVFTDAMGKT… |
| A0A257TJZ7 | 18-258 | DAGKPGHPANAKEEAPVPVEERIVYRLFRFFDFNVEPGKTYCYRVKLVALNPNYELPARLLARPTSADELFLEAKWSAPTPSVAVVA… |
| A0A3C0WK57 | 5-271 | None |
| A0A2E2AYN4 | 396-601 | None |
| A0A3D4P939 | 548-746 | None |
| A0A1G2Z6N1 | 84-351 | None |
| A0A524KSS4 | 157-408 | None |
| A0A7W0M859 | 271-486 | None |
| A0A7Y5VW43 | 116-339 | None |
| A0A847I6Q6 | 1-206 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.