DPCstruct | MC24739
Metacluster Properties and Pfam Annotations
| Number of structural domains | 165 |
|---|---|
| Mean domain length (aa) | 88 ± 18 aa |
| Standard deviation of domain lengths | 17.86 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 77.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 29.63 |
| Pfam Score | 91.13 |
| Assigned Pfam label(s) | CL0509- CL0198 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V5ZF24 | 3-68 | VPDVRVEELDFSVRTYNCLKRAGISSVRDLVHRTHHELMSIRNFGKRSLLEVREKLAQLGLTLRGE |
| Q14PS2 | 27-109 | NEIQEQITIWLEMDETERNQLLNHSIDDLEITQRTQICLEKAKIYRLSDLVSKTENEIKNIKNLGEKSLTEIKEKMHELGLHF |
| A0A7C1DL71 | 22-131 | None |
| A0A1F6XIJ6 | 79-142 | None |
| L0DRP4 | 127-223 | None |
| A0A0S8BQP2 | 2-71 | None |
| A0A1B8PU52 | 19-129 | None |
| A0A7C0Y666 | 9-120 | None |
| A0A1B0C7F8 | 408-501 | None |
| A0A5C5NP52 | 5-70 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.