DPCstruct | MC24737
Metacluster Properties and Pfam Annotations
| Number of structural domains | 63 |
|---|---|
| Mean domain length (aa) | 117 ± 24 aa |
| Standard deviation of domain lengths | 24.26 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 78.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 14.61 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20874- PF11083 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R7TZN0 | 3-93 | KVWHTLVVSYEQVVAEFYNSLIIAMPQNKKYKKYCFYFPKKMASYKNDSWLLRFTDDWNFNVFLKVKNNVGEYETIDEVKLTAQELI… |
| A0A6I7GNZ2 | 10-117 | KNQNVENYFISKGFIPFTTDKASFINLPNHNRHIGFWLSNKFIYPSEKHSEQVAIGLIYDNSYPIVKYDENLKRHIWKYLTGTELIN… |
| A0A1I2EHI1 | 2-85 | None |
| A0A292G1X2 | 71-161 | None |
| A0A4D8RL32 | 29-103 | None |
| A0A150NJZ6 | 36-183 | None |
| A0A6M5FYE6 | 183-274 | None |
| A0A7Y8VR22 | 402-509 | None |
| A0A1C6G879 | 1-126 | None |
| A0A1C6GBE9 | 479-596 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.