DPCstruct | MC24735
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 179 ± 19 aa |
| Standard deviation of domain lengths | 19.30 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 22.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0Q7TNE5 | 1-171 | MPTLLRGEDAKALHKLSERINKTVKPADALEEMWVADVVHLQWELQRLQESKAQLIHLKHEEGIREVLTALIGGVKAAGLLAGRKVG… |
| F7QQG4 | 1-205 | MSEQPVKSARQTETFDVPQEFYDLLGSPTFAPSDNSANYSLIVERMLESIRPKDFIERLFVRDLIDLTWEECRLRQIREALLGESRS… |
| A0A482Z1T4 | 3-184 | None |
| A0A4V1WDL3 | 1-183 | None |
| A0A3N2QSH8 | 3-145 | None |
| A0A327KQD8 | 18-198 | None |
| A0A6L3SRY8 | 190-403 | None |
| A6FUX1 | 19-194 | None |
| A0A0H1R5G0 | 36-209 | None |
| A0A840N5T0 | 2-160 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.