DPCstruct | MC24731
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 314 ± 50 aa |
| Standard deviation of domain lengths | 50.06 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 71.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 44.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D2QA90 | 2-272 | NLPESVLLCLFPNGLVLSRQSVALSDGGGEEDEEEVYGVDFDPDCFQFVLTFFRTASDNFYGTATTPGLFGAQQHLFESPTSEFGPA… |
| G3AV26 | 36-366 | SKIHLNIRGKEFTITRDELMSLPESILLCLFPNGVFLDLNGQVITNLTEEDVVYVNFDPGCFKYIMEVFSQAQKDLEESYALSPQTS… |
| H0EEB3 | 122-413 | None |
| I1CD33 | 1-220 | None |
| M1W108 | 900-1188 | None |
| A0A178F3E0 | 187-476 | None |
| A0A2J6Q9E9 | 799-1085 | None |
| A0A369GVF7 | 772-1058 | None |
| A0A0F2M6C6 | 363-662 | None |
| M2MW25 | 2-368 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.