DPCstruct | MC24730
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 179 ± 19 aa |
| Standard deviation of domain lengths | 19.42 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 26.16 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0321 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G0VET5 | 34-201 | AVCHSAYNGCRNLDFDYWFNSRNIMRYYMDVEKVMWLQDNLYEVTIHVHGQQQIDLKYLSMLYIHEIDGPKRGITLFHRGLNISDII… |
| Q12140 | 2-142 | SQQNILHYDMDVTSVSWVKDNTYQITIHVKAVKDIPLKYLWSLKIIGVNGPSSTVQLYGKNEKTYLISDPTDFTSTFQVYAYPSSDG… |
| A0A1L0BLH4 | 15-204 | None |
| G0VKF2 | 3-179 | None |
| G0VHV0 | 24-217 | None |
| A5DJ40 | 362-512 | None |
| G3AVC2 | 48-221 | None |
| A0A1E5R848 | 6-215 | None |
| A0A642V4D0 | 21-197 | None |
| A0A7H9AXT5 | 41-248 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.