DPCstruct | MC2473
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 149 ± 19 aa |
| Standard deviation of domain lengths | 18.99 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 83.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 23.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E4IRV0 | 15-146 | QMPNTILRDLAWSFSRDTPESIAEWEEALSAYGEDIGMPVDREKLWLVLPVRALDVQYTYWVVGNNNEWQPKSRVVSVRASRLLSCS… |
| A0A6H9XAI8 | 37-197 | LSLNNGEESRVFTVLRKVPMLDDIRWEFGSRRYLSLEQFVTEVSRVNKSAWPHDEIVMNNPKVAFEYSALISSLDELLPCENLAHAD… |
| A0A7W4EY59 | 287-441 | None |
| A0A117J262 | 316-503 | None |
| A0A6N3CVP2 | 62-226 | None |
| D2RKA8 | 238-386 | None |
| L1NXQ2 | 557-714 | None |
| D1W5M0 | 4-133 | None |
| A0A2G6LSD2 | 438-574 | None |
| A0A1Q6GAW7 | 434-568 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.