DPCstruct | MC24726
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 182 ± 29 aa |
| Standard deviation of domain lengths | 28.65 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 83.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 33.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0182 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K2PI82 | 2-150 | ILFALGGSTYGMAEETLAFYALIIPVMIAVGFDTVVAVAIVLVGSQVGCLASTVNPFATGVASQAVGISMGQGMGLRFFMLVVLTGI… |
| A0A2S1ETY4 | 17-177 | ALSTKTKGKEFILVFLVTVLLALGGTLCGIEEEAVAFYPILAPVFIAMDYDSIVCVGAIFLASSLGTTFSVINPFSVVIASNAAGTT… |
| U7V0K3 | 11-190 | None |
| A0A1S8DM02 | 3-146 | None |
| A0A840MAN3 | 68-223 | None |
| A0A084U4W6 | 192-394 | None |
| A0A396Q462 | 8-192 | None |
| D6S3Z2 | 128-345 | None |
| A0A7J9VHW8 | 37-216 | None |
| A0A7X9K9Q1 | 79-311 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.