DPCstruct | MC24725
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 143 ± 26 aa |
| Standard deviation of domain lengths | 26.02 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 85.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 24.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A136KUR5 | 98-216 | SNQRPNQNNQPNFGASWFGLTDAVIRLHWGRDDAIIKILSDKFNVSEAEVLSLLAPAQYPVPFAVMPLQDAIEYAYYMINVTIGRYR… |
| A0A256VHW6 | 24-173 | IQNGGNSTPNIIPFAQTDVIFTLLTGISPELNELHEMQIGKIGRELSEYNETAVNSLIEKYKQQFNDYKQKEYIDPIINLLEGLSIK… |
| A0A529M0H6 | 67-212 | None |
| R6IPW7 | 45-204 | None |
| A0A1Q4DQN0 | 105-228 | None |
| A0A2U8TME7 | 19-161 | None |
| A0A382RIY2 | 133-300 | None |
| A0A519ECF8 | 2-134 | None |
| A0A0M1W6W5 | 72-236 | None |
| A0A1Q3KPY3 | 34-158 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.