DPCstruct | MC24721
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 154 ± 18 aa |
| Standard deviation of domain lengths | 18.04 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 79.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 11.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V1SN44 | 8-138 | FKGFMDGQEWTNWANRFLNEAYDPSVDPNIKKFEVILTPDHFIRLRKTYQQGKQEYFSFKISRLNTLDLKPGNANTDTIAFKTLADD… |
| A0A1I6NVB3 | 13-159 | TMLNINDIVGQEVFQNLNNLPNTIEVKAPEFNTEKKYYFKFDSFQNVLLIQDLRKSKKDKVHYYQFLYEIPLNKLNSKSFKISKDID… |
| A0A5D8YHE0 | 14-157 | None |
| A0A084TLF7 | 1-146 | None |
| A0A318UFW9 | 14-168 | None |
| A0A4Q6BGJ2 | 16-144 | None |
| A0A1E4AQ40 | 6-155 | None |
| D2QC24 | 6-165 | None |
| A0A1K1PYP6 | 23-190 | None |
| A0A2N0EUY3 | 163-305 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.