DPCstruct | MC24719
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 107 ± 10 aa |
| Standard deviation of domain lengths | 9.92 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 22.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4D4KRW9 | 122-226 | AAFTPTEADFGLTLHGVPLIELGDEGGLLMALGHVPARQFAAAVSAWPRAMYGMRYRPDPPTSSPDLSPAPEYLWGRGEAYPTRSEC… |
| A0A1M3AIY6 | 21-112 | VLVTDEGEPQAAFARGHRDIATLRHTAEDAIIAAFAAYSAQLAGDVIEILEAAGEAVISHGWMRMSGADATATFFEFCQPTANGAFP… |
| A0A6N7ZN57 | 134-245 | None |
| A0A3R9TJT0 | 7-116 | None |
| A0A5C1WCE1 | 3-94 | None |
| A0A2L2MZ30 | 121-221 | None |
| A0A3N1SMM9 | 1-116 | None |
| A0A0D5A6J2 | 59-181 | None |
| A0A4R6NZL8 | 87-198 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.