DPCstruct | MC24716
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 100 ± 4 aa |
| Standard deviation of domain lengths | 4.32 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 92.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 29.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C1C334 | 19-116 | EEWDRVNWLINHLDDYAWGWSDLQQVIWKLEDPLWGGTPYGGCSAITSVGLQMNSDAVANGDGFVPMPGGWAMVCFVPTGTPPGQQN… |
| A0A1W1XS06 | 106-202 | RLYSSVDPLLPGHLARLSWNEINYLVNHKAGTPKEVQAAIWHLVDGRTRGLTPAARKMVEAARRNGAAYIPGPGEILAVICEPFEDV… |
| A0A662LSJ2 | 6-103 | None |
| A0A661A789 | 122-226 | None |
| A0A523TYL3 | 86-193 | None |
| A0A7C4ZR11 | 87-182 | None |
| A0A7J4IAN5 | 88-184 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.