DPCstruct | MC24714
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 93 ± 13 aa |
| Standard deviation of domain lengths | 12.61 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 90.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 24.30 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0423 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V0RK84 | 2-105 | ATVTLISDAEATPEVRAVFDDIRATRGSDFINNFWRALAHDPALLSATWQRLKSVMGPGTLDPLTKELIYIAVSVTNGCEYCAHSHT… |
| A0A7C0ZPL9 | 2-82 | VARIKITDYREASGRLLEIYHDMIRKRGKPAEVHKIQSLRPVSIAKHIDLYLDIMFSKSDLSRADREMMAVVFSIKNGCEY |
| A0A2V7S063 | 55-137 | None |
| A0A6L8E5G9 | 4-91 | None |
| A0A7C2XTK4 | 21-108 | None |
| K9Z663 | 1-91 | None |
| A0A3M3V4B4 | 16-97 | None |
| A0A317HD63 | 21-118 | None |
| A0A317HTL0 | 1-89 | None |
| A0A0F9EU67 | 14-105 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.