DPCstruct | MC24713
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 142 ± 14 aa |
| Standard deviation of domain lengths | 14.19 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 88.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 31.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6L8TZ01 | 212-351 | SCYRCKRFDQYLQTETEPMPEFRKVENDYLLAEAAARTGKLQEAADIINSSPRVTRGGLPPVPVEMDSIMEAIHHERMVELMNTGFG… |
| A0A7C0WJG0 | 29-185 | SYYHSYKYIDYYKNGYVGWAHIMSVAEMDFLRAEAALRQGDAQTAVDLINKYHVGIGEMAPVTAAIPVGNPGDLRDARPDIGDFGNS… |
| A0A849H983 | 93-220 | None |
| A0A7X7H7K8 | 73-197 | None |
| A0A1D7XRM9 | 281-401 | None |
| A0A3D2IDQ9 | 3-164 | None |
| A0A7Y7BCR7 | 1-143 | None |
| A0A838NXU3 | 1-128 | None |
| A0A7C7LLG6 | 7-156 | None |
| A0A1G0PGS9 | 83-244 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.