DPCstruct | MC2471
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 172 ± 18 aa |
| Standard deviation of domain lengths | 18.17 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 83.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 20.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G2DLL7 | 14-176 | VAAVTADPVFFDVTRKKMIIMNLSTYGIYYLYWVYKNWVVIKESEKIDIVPFWRAFFSIFYINSLYNRIYKAAVARGFRTLATSNLA… |
| A0A3M1B8A3 | 15-170 | EMPRTREELPLYDVSLTKFLLLFVFSLGLYQFYWGYRQWRCIRNAGNGVLPIVRAFFLPLFLYAQIRHTQEIFARHGHPERIAALPL… |
| A0A562KUU5 | 2-142 | None |
| A0A6C5NA01 | 3-150 | None |
| A0A5N9GWJ5 | 24-216 | None |
| A0A382MDC9 | 63-219 | None |
| A0A3N5IZH8 | 90-285 | None |
| A0A1Q6UB53 | 110-287 | None |
| A0A1Q6UB60 | 95-277 | None |
| A0A1V5LUB4 | 30-219 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.