DPCstruct | MC24709
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 161 ± 19 aa |
| Standard deviation of domain lengths | 19.21 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 67.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.58 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 46.03 |
| Pfam Score | 87.51 |
| Assigned Pfam label(s) | PF00010- PF12232- PF01586 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0L8HXY3 | 2-133 | ASSPSSSSSSSSASDEVDEHVPHVLAPGYHGPNRRCLLWACKACKKKTVTIDRRKAATLRERRRLRKVNEAFETLKRRTCPNPNQRL… |
| A0A3Q0FMC9 | 20-176 | GALQQLEMAEGSPLYPGSDGTLSPCQDQMPPEAGSDSSGEEHVLAPPGLQPPHCPGQCLIWACKTCKRKSAPTDRRKAATLRERRRL… |
| G1KPV6 | 53-222 | None |
| A0A1B0AVC0 | 82-216 | None |
| A0A803K099 | 55-175 | None |
| A0A6P7ZUE4 | 11-199 | None |
| A0A4Y2IQ79 | 161-336 | None |
| E3MS04 | 77-258 | None |
| A0A1J1J6V5 | 71-228 | None |
| A0A7M4E604 | 23-164 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.