DPCstruct | MC24707
Metacluster Properties and Pfam Annotations
| Number of structural domains | 75 |
|---|---|
| Mean domain length (aa) | 245 ± 48 aa |
| Standard deviation of domain lengths | 47.67 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 82.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 23.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07217 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A817Q4P2 | 6-264 | HTEITQQAFIRSLARYFIDTHSIRHQEINKNQEYTIDELYRLAYPHWTTNQLQQRTYPLKSILDTILAENGLVDFDAWTKKLPAAHF… |
| A0A822B5H2 | 31-292 | THYGITVCALCRVTIDYLKSAYNIDTTYLEIKFNEINGQCQGNIVNDIINLLRSSQAKGINPWLYSTTIKTIASANTKTDLKEMFKE… |
| A0A671TZZ7 | 23-229 | None |
| A0A833H2S0 | 39-261 | None |
| A0A838RCF9 | 1-218 | None |
| A0A0G4GXY6 | 12-253 | None |
| A0A7C2QJN7 | 37-252 | None |
| A0A4R9LAT8 | 5-197 | None |
| A0A814SBL7 | 258-540 | None |
| A0A0X1T770 | 8-200 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.