DPCstruct | MC24706
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 438 ± 43 aa |
| Standard deviation of domain lengths | 43.10 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 78.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 17.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A822B400 | 14-412 | FPNEIIDQALAAHLKILDYSCLSEKEKTKLSWIDRMMEDVKQDQHVIISLKQMREICTQFSEHGYPHNMPRMSYPLNRISLMEILEK… |
| A0A183E859 | 190-576 | LSLLWDLFRDDRLPVEMVDAALDAHFSVLENAVPAEEVRRHYIERCIDELLIDSVFVLPTLKHMQRLMMLVPENDFCYGKRMTRAEF… |
| A0A653DEF6 | 358-914 | None |
| A0A132AFI7 | 294-738 | None |
| A0A2G8LKV2 | 47-449 | None |
| A0A6V8QX85 | 2-419 | None |
| A0A091E5J1 | 63-460 | None |
| A0A3M7PIB4 | 21-459 | None |
| A0CLR6 | 173-634 | None |
| A0A7R9CVF8 | 11-443 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.