DPCstruct | MC247
Metacluster Properties and Pfam Annotations
| Number of structural domains | 65 |
|---|---|
| Mean domain length (aa) | 122 ± 14 aa |
| Standard deviation of domain lengths | 13.90 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 82.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 15.11 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A839URU6 | 8-118 | TLSTVELHDKAGLPVQLQIRLYEYQGKYALFMSDAPAAAVLARNAATLINQLANRLELPVADTQFFRHIYLPHQGSVFGSFQLDWRP… |
| A0A2E3QVZ3 | 36-150 | VQEWQGYALTWRSYDGGTRSATATLYGNTSRHDSDERPYTVVLVQGEGNRAPITEDAKYLAEIIGRDLGVSPTRLAFLFRFAVEDTD… |
| A0A7C5RER0 | 3-117 | None |
| A0A3A4ZSR5 | 21-166 | None |
| A0A4V6PF00 | 3-103 | None |
| A0A4R2RMU2 | 6-137 | None |
| A0A0M8WAG9 | 3-109 | None |
| A0A1R0KDT0 | 217-339 | None |
| A0A2N6BK96 | 4-130 | None |
| A0A4Q2UCL6 | 3-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.