DPCstruct | MC24698
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 222 ± 26 aa |
| Standard deviation of domain lengths | 26.39 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 28.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16969 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C3QFL5 | 3-211 | QNEISVRALAVVNEERSIHGLRFGDYARYRRHCSNKLHRLRQTLKLGHGKEKNFRKLPEIPTENLKDGHLLLDLFEAERAWAYAQEL… |
| A0A822ACH6 | 13-222 | TSAPTTSQPTKVAPTLKLDILRIIRLCQQQHGLRHGDYQRYRSFCSRRLRRIRKSLELTYGNQKKFQKPIITDELVAKDSRYLLLPL… |
| A0A811L6P9 | 1-270 | None |
| C4YP62 | 3-238 | None |
| B8P016 | 2-216 | None |
| A0A369RQW6 | 7-247 | None |
| A0A4U5MP51 | 6-241 | None |
| A0A3Q4M714 | 10-187 | None |
| A0A058ZDN4 | 5-214 | None |
| A0A5A8D6W9 | 1-262 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.