DPCstruct | MC24696
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 68 ± 4 aa |
| Standard deviation of domain lengths | 3.74 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 85.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 70.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A820VQ75 | 209-277 | YLMTQIPYGSFDRGDQGNVICRAIHTNFVPLLPSVHCPHVGPTGGGACTDKTIDFYYNQINFLGCAHKQ |
| A0A817XBQ9 | 138-203 | QYLMTQIPFGLLDRGDQGNVACRIIHAIFVPLLPSVHCPHVDPTGGGACTNKTIDFYYNQPNFLGL |
| A0A821HTL6 | 40-111 | None |
| A0A819DBU8 | 1-67 | None |
| A0A815T1J8 | 70-129 | None |
| A0A822HIJ2 | 31-99 | None |
| A0A814RIR1 | 86-160 | None |
| A0A822D8M4 | 114-179 | None |
| A0A815B886 | 144-215 | None |
| A0A821FIL4 | 109-174 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.