DPCstruct | MC24695
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 690 ± 38 aa |
| Standard deviation of domain lengths | 37.58 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 70.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 20.54 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15917 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A821ZWE5 | 1-676 | IRLDVMAMMYLIWLGIFLISSRRFIQRIWSIYIFFHIIVFPVQYMSAVGAPPNLGFEYPWLAVNFNSWPQLKRWLYLPDYVTPPIAT… |
| A0A653DHE2 | 9-721 | RMDGYAIMYSVWLCLLLILRRSILRWIWIVFVVFVAFSLIWQFLMSIGPPPNLCIEYEWETRTRYWTIAQDFWFLVDNYRSPPSRKL… |
| A0A7J7JSE9 | 382-1140 | None |
| A0A077Z8J1 | 422-1138 | None |
| A0A820YIR4 | 1-658 | None |
| A0A5S6P970 | 338-982 | None |
| A0A287KXZ6 | 2-666 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.