DPCstruct | MC24693
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 343 ± 23 aa |
| Standard deviation of domain lengths | 23.04 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 86.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 18.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P6JRK5 | 2-351 | QLLDKMRPALEQRIAALPSPWPRYTLFLSFSDGRRRAAVVHGSGADVEVLWSEVSAACQRLAARRNMTVCWLRADWVTRAQPLTWKA… |
| A0A321LWK4 | 439-753 | RDIAIAQLLGVPETTQPLSAKALPQGADFLFVTIYLWGRLRGCMGLEISSMHGDEELRGLVLSALHDERFKHVQASSPEAVAAGISL… |
| A0A7X7MJ06 | 2-321 | None |
| A0A7X7XF75 | 223-570 | None |
| A6GMC9 | 2-326 | None |
| A0A2E6EN61 | 158-559 | None |
| A0A7X9I6V3 | 1-322 | None |
| R2SB10 | 6-358 | None |
| A0A1E3X761 | 335-678 | None |
| A0A4R6FYC9 | 7-359 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.