DPCstruct | MC24691
Metacluster Properties and Pfam Annotations
| Number of structural domains | 121 |
|---|---|
| Mean domain length (aa) | 146 ± 17 aa |
| Standard deviation of domain lengths | 16.58 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 12.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I3X8I0 | 368-505 | VTAHQHLTPEDLPHRPSERVQDLALRALELALDRAVADAAGSAPFVLVREGYDVEVLDFPHSDAGLAQARDAARSGGYTAAAVAWTS… |
| A0A321LU67 | 4-142 | LKSLAYELLHEAQQALQQEENLTPTAVVITPAENLIFDLEYGNDEEREELYAEMIEVALEKNATAILTVNDIYLDNAGAPVKLEGAG… |
| A0A431HNP1 | 1-176 | None |
| A0A6J6RMX9 | 6-134 | None |
| A0A317MZ44 | 9-143 | None |
| A0A0S8A807 | 183-318 | None |
| A0A191ZVZ4 | 14-157 | None |
| A0A0D4C0Q1 | 158-295 | None |
| A0A844YWV5 | 2-156 | None |
| A0A3D2C3P6 | 1-138 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.