DPCstruct | MC24690
Metacluster Properties and Pfam Annotations
| Number of structural domains | 51 |
|---|---|
| Mean domain length (aa) | 112 ± 12 aa |
| Standard deviation of domain lengths | 12.22 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 79.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 32.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03626 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A521YRJ5 | 3-83 | YVAVWAALLVLLAATAGSSYIPMGGWNAFANMAISSLKALLVALFFMQLRHEGALVRLAAVVALVWLALLFGLSWTDYSTR |
| A0A321LC23 | 2-98 | AQNGSHGHPTHGVYYAVFGALVIGTLLTWGVAFVDLGIFNPIVALAIACTKATLVILFFMHVRYSSKLTMITVAAGFFWLMLLISLS… |
| D0LJB2 | 7-119 | None |
| A0A661A2Z9 | 3-104 | None |
| A0A395M294 | 2-110 | None |
| A0A3M1BGC4 | 42-141 | None |
| A0A2M8G0A8 | 9-108 | None |
| A0A369KNB8 | 12-126 | None |
| B9XE48 | 2-105 | None |
| A0A2T2TJR1 | 2-118 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.