DPCstruct | MC2469
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 150 ± 17 aa |
| Standard deviation of domain lengths | 17.01 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 21.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A497CDM1 | 2-125 | RTNKQKLDLERYSRRLRVYEEVKKILCILRDDVETSVGDLLKFRTSVSEADFLFNHEIPKYLDQIFERGWSLLKLQKQYRSFNQEEP… |
| A0A2N9LEK1 | 17-173 | MTPECFLEWMKALGVPLLAVVVSATVAVFSWWQVRIAREKLRHDLYDRRFAIYMAFHEMLVAFADKPYAYDFDPELRKANAARAHSP… |
| J0HAX9 | 7-148 | None |
| A0A1Y5Q386 | 2-153 | None |
| A0A2V3ZPV6 | 152-299 | None |
| A0A6J5EW85 | 3-130 | None |
| B8FDU8 | 32-188 | None |
| A0A0M3ANQ9 | 2-200 | None |
| A0A0B4XZP5 | 41-201 | None |
| A0A1Y0FV19 | 3-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.