DPCstruct | MC24688
Metacluster Properties and Pfam Annotations
| Number of structural domains | 83 |
|---|---|
| Mean domain length (aa) | 54 ± 3 aa |
| Standard deviation of domain lengths | 3.29 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 71.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 66.26 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q96LR4 | 48-97 | IKQGTCEVVAVHRCCNKNRIEERSQTVKCSCFPGQVAGTTRAQPSCVEAS |
| A0A672JJX9 | 7-65 | FQSPQVHVKAGTCEVIAAHRCCNKNKIEERSQTVKCSCFPGQVAGTTRAAPSCVDGTAA |
| A0A3B5Q2Z9 | 41-92 | None |
| A0A556UG53 | 342-396 | None |
| A0A4U1F8J8 | 54-107 | None |
| G3IDS6 | 26-81 | None |
| A0A4U5UQ07 | 144-200 | None |
| A0A4U5U9K6 | 74-127 | None |
| A0A674KCA0 | 27-77 | None |
| A0A7J8HQD3 | 40-86 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.