DPCstruct | MC24685
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 156 ± 24 aa |
| Standard deviation of domain lengths | 24.32 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 80.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 41.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K5W3S0 | 19-155 | KSFSLVPEPRSSVPLQWAHFGPGAIPNALADTPCAAMNVTELLERLNDVLGTSYSLNKPGLEQCLNHFLRSSRDFGQVYGSLRPHWQ… |
| A0A2H3DPB6 | 3-157 | YPFRLSFEEDDDDDNTLLPQALEDISVHEVTISAFADMGQSDSSIIVPLQWLYTGRKPVISSCLADTPCAVFNVLGLLDILNGILRT… |
| A0A284R2W8 | 21-170 | None |
| A0A284R8U0 | 590-776 | None |
| K5VQK0 | 1-124 | None |
| K5VXX9 | 79-271 | None |
| K5VXX4 | 89-227 | None |
| K5W3M0 | 2-126 | None |
| K5W3R4 | 55-192 | None |
| A0A284S7U1 | 13-187 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.