DPCstruct | MC24682
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 162 ± 7 aa |
| Standard deviation of domain lengths | 7.43 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 74.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 35.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H3DLX3 | 1-160 | MQASPPNLSQDDRSVIFDLLDMRLNRMTLQALLYGLYTGIVAIVLWVMFSPPKQSRGTFLRTMIIMLYVLLTIAYAMDWAFERRVFV… |
| A0A284SCI2 | 3-154 | TQNSIAPPDLTDVDKAIIFQILDAELNSVILYSLLIGIYTGIVAVTLRNIYMNKSQPIGRVMVLIVVLLHAMTIFNFASCWAYIDSM… |
| A0A284R2S6 | 321-481 | None |
| A0A2H3EBW0 | 1-153 | None |
| A0A2H3E8Z4 | 1-159 | None |
| A0A2H3BB96 | 1-179 | None |
| A0A284RRJ1 | 384-549 | None |
| A0A2H3DQ16 | 1-168 | None |
| A0A2H3DMP2 | 1-162 | None |
| A0A2H3AUZ8 | 1-158 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.