DPCstruct | MC2468
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 100 ± 7 aa |
| Standard deviation of domain lengths | 7.10 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 30.57 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A127KAN0 | 4-92 | PATADAAGFAHCLLSRLPGADNDAMARAALHLCLQSNPGGFLSVEQGAGRGLFSFKSGAECTIEKAKGTRSNQAAHLIASACRKLYD… |
| D8P5X8 | 18-109 | YAGWFESATFDGCVLDKMPGVSNALAAKLVLASCVSFARANSGSGRGFFAKYASGADCFADKGKSVGDQLGVTYVFAACHQLYDRPE… |
| A0A3R8VSD3 | 62-160 | None |
| A0A3D8JRS3 | 6-122 | None |
| A0A1S9CY76 | 36-134 | None |
| A0A6N8S679 | 9-107 | None |
| A0A423KIX6 | 87-183 | None |
| A0A357YRD6 | 7-108 | None |
| A0A4R7FB69 | 1-96 | None |
| A0A148NA90 | 1-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.