DPCstruct | MC24679
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 149 ± 13 aa |
| Standard deviation of domain lengths | 12.53 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 74.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 30.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A1T6E6 | 109-249 | QAPRVETELLYLPKAQELARPNDLLSKPPYRITVHARSSAVDILSNHSPSLEMLEAYMTRWCRSDYNYTNKPPIVDLKLHNSPWGLG… |
| A0A2H3DGE7 | 1-133 | MTSPERFPVLSSLPPPSDLFKSTAPYILTVSLYDQNLVVHCSHEPTLKLLKGYLERHQWTKAHSVVSSKLTLVESDFCPGTMDTLIV… |
| L2G9M9 | 168-321 | None |
| A0A284QPV1 | 106-238 | None |
| A0A094FQQ7 | 520-678 | None |
| M1WF73 | 1-168 | None |
| A0A2K0TV09 | 133-276 | None |
| A0A369K5J4 | 176-337 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.