DPCstruct | MC24678
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 155 ± 16 aa |
| Standard deviation of domain lengths | 16.18 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 75.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 36.92 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04987 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5E4AZ65 | 87-251 | FQRLNSILLSLMSTYLLLSTGYEALFPLVLSCLMFIWIHMEQETLQQSGVCCKQKLTSIQFSYNTDIIQFRHLCLDDIRRAFFLVFF… |
| A0A2H3DG13 | 3-150 | KILMYFLVFGPCFVILSISVEGMFYVAYSMTLLCWIEVESSLRNAQPSKPENAQVYRFQADDLRIVLFFLFFVQVGFFGTGNVASIS… |
| A0A1D6HBK9 | 236-370 | None |
| L1IZV6 | 417-543 | None |
| A0A0C9UX36 | 389-565 | None |
| A0A6J2JKV5 | 12-175 | None |
| A0A5N5F7G9 | 99-252 | None |
| A0A0U5FSR1 | 2-170 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.