DPCstruct | MC24675
Metacluster Properties and Pfam Annotations
| Number of structural domains | 106 |
|---|---|
| Mean domain length (aa) | 239 ± 39 aa |
| Standard deviation of domain lengths | 39.47 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 76.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 16.05 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B7F6G7 | 181-405 | YAIDSLTSEGSTSPMSVQQIQTHLKSLESFSSNGDIHQTYAVARLWNLVIQSRIINKYGTPDARLDRFISITDNPPTFAGAYATIAK… |
| A0A067TGP3 | 79-367 | MQAKIPKFTDSLLPRILSFLRYLTVQIYQNLLLHLPSHYFTRVANIYQNAELTKLEVGSMISWVKSGRHRRDDEQLPPAFEKIKKSW… |
| A0A5C3M3G7 | 1-271 | None |
| E4ZSL6 | 51-315 | None |
| A0A1J8Q4H8 | 1-281 | None |
| A0A3N4L2U3 | 16-254 | None |
| A0A165Y806 | 375-622 | None |
| A0A284QWN2 | 234-464 | None |
| A0A165X6P9 | 250-457 | None |
| A0A5C3M0H7 | 203-534 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.