DPCstruct | MC24674
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 386 ± 71 aa |
| Standard deviation of domain lengths | 71.21 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 73.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 19.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y7T4X5 | 71-352 | SSDTMPRNNAFIRVKDNKIQPIVMQGLMQYTSAIFFFDHLVRLTSTQPMNGSVLRYPRQKGWIGKEGKDKTGKNNVIKALKETKSLI… |
| A0A067TGP7 | 20-386 | TAADSPRANSLLLAAFPWDTDSLTEPVLADVFQGSSTLDKLLKHLRIEGADMETGEPATSNTLVSFKKAKKPVKGVKVNNDLAILVC… |
| A0A4Y7T115 | 105-403 | None |
| A0A0C9WZP9 | 33-467 | None |
| A0A0C9WZC5 | 1-308 | None |
| A0A0C9WML4 | 7-439 | None |
| B0D1V2 | 5-474 | None |
| E2LS48 | 1-296 | None |
| A0A5E3XGC1 | 3-430 | None |
| A0A4Y9YTB9 | 69-461 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.