DPCstruct | MC24673
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 204 ± 37 aa |
| Standard deviation of domain lengths | 37.47 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 80.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 37.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5M3MY62 | 203-417 | TFCAFVCPSPVSPHLPRPRTQIDLVLPPAAAFQKPGCAPLLWPPVLGQQSVQWTDVFALVQQPEHLWDVWKPSKLLDSMTLDEIWKC… |
| A0A067TG64 | 34-210 | ASPEQPPPRTQQDLVLPPRNAFAMATYPPFTTRDCTWQYIFDRITDPPYLWLSYAPGSLGDYPDVKSLWQAWDEGTFVTDVGRKPAL… |
| A0A4S8KYY6 | 2-134 | None |
| A0A4S8KVQ1 | 133-347 | None |
| A0A4S8M2N2 | 999-1227 | None |
| A0A4S8LPF5 | 56-235 | None |
| A0A1C7LNI2 | 854-1069 | None |
| A0A409Y184 | 659-865 | None |
| B0E1N5 | 15-264 | None |
| B0DRT7 | 1-158 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.