DPCstruct | MC24672
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 74 ± 15 aa |
| Standard deviation of domain lengths | 15.37 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 78.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 47.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A067TDQ0 | 15-79 | HPRNLQGLERLSKDWNSLIYVFFKPEPAIEYVNGRRVHVFECTAKPCKGRGGRYVRRYLDTGDAK |
| A0A0C9YHG6 | 143-205 | LDRMKKGWNTTVYAFYDPNPATEYNSNGRKCHVFRCTGRGCTQLIKRYLDTSDAQSTGNMRRH |
| A0A409WYH6 | 17-81 | None |
| A0A4Y9Y1G4 | 45-142 | None |
| A0A5C3P2C7 | 133-232 | None |
| A0A0C2WKX5 | 1-77 | None |
| A0A0C3CPY7 | 8-66 | None |
| A0A284SCV4 | 127-206 | None |
| A0A0C9T1Q1 | 2-62 | None |
| A0A0C3PCZ9 | 13-114 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.