DPCstruct | MC2467
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 256 ± 50 aa |
| Standard deviation of domain lengths | 50.26 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 83.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.52 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 17.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J4KNJ1 | 5-187 | GRLALISNGWAHRIVRTAGDTYEDNYGILRYTSENAYFLNQIYNYEIGGIVLNQTEGAVFIIKPEFSAVYNASTRIANLSLTCIDLV… |
| A0A2R6GZR1 | 12-298 | CQAVVVPDRNRQVEFTYNRNVQQQLQELRGAIVSMPNRQSTGSVTVPLGTSYPSRLVALNTEPPVGSLRTVGTGSAAVNVSLSNATV… |
| A0A6A9T054 | 20-366 | None |
| A0A2R6G2J5 | 4-224 | None |
| L0JM18 | 5-199 | None |
| A0A847UBJ6 | 175-434 | None |
| O28644 | 2-154 | None |
| A0A6B0SIN6 | 13-238 | None |
| A0A346PAJ0 | 6-278 | None |
| A0A2R6HZW5 | 20-362 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.