DPCstruct | MC24669
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 105 ± 16 aa |
| Standard deviation of domain lengths | 15.88 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 78.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.78 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 43.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I2I1M8 | 29-137 | TRTVAQCADGSDNDGDSLVDFPADPGCASASDTSEAEPPRPPACADGLDNDGDGKTDFPTDPGCTAAADSDEADPIPPPACADGLDN… |
| A0A7Y6PJA8 | 148-260 | TSACDNETDDDGDGRTDYLADGTGDPGCADAADNSENGAGACDNGTDDDNDGAVDFLVAGGGDPGCAGPDDDSERGTSACDDGIDND… |
| A0A7C5J7L6 | 662-764 | None |
| A0A2M8KWA8 | 397-509 | None |
| A0A2G9Q085 | 463-572 | None |
| A0A7W0VHY5 | 20-131 | None |
| A0A2G9NEZ3 | 148-253 | None |
| A0A0G1TAI7 | 74-184 | None |
| A0A7V8ZFL9 | 312-426 | None |
| A0A7W0LLB2 | 282-391 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.