DPCstruct | MC24666
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 80 ± 12 aa |
| Standard deviation of domain lengths | 12.18 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 91.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 30.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R8NPN2 | 1-80 | MVNVEPIIINNYTFIAVSVKLPKTNLLAVMSDKGYIMCGALDVGLLNEKLGDRGIIAGRAVGVRTIEQLLEAPLESVTIE |
| A0A137SJR7 | 3-83 | AKMIRYELEKPLLIIKEKQGMLACAYINVETCNKTNEACAIVSGVSSYEDMMSAKIIAVSNKALNLGVNVGDTGMSAINRF |
| J1L0E8 | 71-155 | None |
| A0A523ZL89 | 11-86 | None |
| A0A523ST13 | 14-96 | None |
| A0A1V6DU75 | 110-195 | None |
| A0A843CZT9 | 25-104 | None |
| A0A150L2P7 | 2-55 | None |
| A0A7V3FYM9 | 2-72 | None |
| A0A7S0HII3 | 3-83 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.