DPCstruct | MC24664
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 532 ± 38 aa |
| Standard deviation of domain lengths | 38.48 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 80.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 19.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A512ISD5 | 2-520 | NVKDRGAKGDGATDDSAALVSADAYAAANGYRYLYFPPGLYYAPAIGQGGKGLSRTILVGEGRLTGASYRQVTPLTGGTTPPPSTDL… |
| A0A2N2DYI0 | 220-755 | VASKYGVDSTIGTSDATTLLNTYFASLKAKGLKYAYFDKPHTYKVNGVLSGVRDLILIGNAKIESSNLANYFINICQTLTEYNGKYN… |
| A0A3D3M4C6 | 13-561 | None |
| A0A2D5J7M7 | 304-781 | None |
| A0A7U4HCC3 | 49-587 | None |
| A0A7W3SYZ8 | 134-685 | None |
| A0A149VF24 | 61-605 | None |
| S6D9W6 | 199-796 | None |
| S6D435 | 13-512 | None |
| A0A2S4LJE3 | 14-455 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.