DPCstruct | MC24663
Metacluster Properties and Pfam Annotations
| Number of structural domains | 142 |
|---|---|
| Mean domain length (aa) | 152 ± 17 aa |
| Standard deviation of domain lengths | 16.56 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 83.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 19.37 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07884 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E9IYI5 | 3-143 | QLNVGILSMCIIALGLSFYALLVEFKKEHDDSYEAMCDISEHMSCTKAFISEYGKGFGLLPKDSLFNFPNSIYGLACYMLFAILTMY… |
| A0A7C4N6L2 | 18-158 | SARCCPSNMNRQRIISLLALVGIVVAGYLTYSHYSGEPVYCGGASSWELVNTSRFAFLLGVPVSTLGLAAYVVILILSLIKSDERRQ… |
| L1K2D5 | 941-1088 | None |
| A0A2V5XI77 | 17-169 | None |
| Q5P1W1 | 118-298 | None |
| A0A4P7U8W7 | 12-182 | None |
| A0A517YWR3 | 12-191 | None |
| K2B172 | 5-143 | None |
| A0A258VQL5 | 1-158 | None |
| A0A2Z4FI83 | 20-194 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.