DPCstruct | MC24660
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 115 ± 9 aa |
| Standard deviation of domain lengths | 9.15 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 89.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 19.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06133 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2W4TP81 | 1-109 | MREGTIERARELGWLLGQTEEYQALARARRALAEDRELTTLLNRLAELDSRMARSLERGEAPAAEDQTEYEESFNKLQASPVYQALV… |
| A0A7C4J767 | 1-115 | MTNTDLTQLPDLMAATQALAENLLASEPFADYQQASTRFNADPQARGLIEQLSQAQAELRRRQTSRGVTQTDVDQLRALQREVQSNP… |
| A0A2N1RND2 | 4-110 | None |
| A0A2N1RSS6 | 1-92 | None |
| V7HZI3 | 7-121 | None |
| A0A2U1JYU4 | 38-162 | None |
| A0A3C0FBV1 | 49-173 | None |
| A0A1G3QQL6 | 15-131 | None |
| A0A242K8M6 | 39-146 | None |
| A0A1N7K1R9 | 2-109 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.