DPCstruct | MC2466
Metacluster Properties and Pfam Annotations
| Number of structural domains | 58 |
|---|---|
| Mean domain length (aa) | 114 ± 12 aa |
| Standard deviation of domain lengths | 12.07 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 17.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08861 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A495Z600 | 9-123 | DFIDKVSAKVRVVPDGEDRFRVFTPFMFDDGDHISIVLKKEQGGWVLSDEGHTYMHLTYDISEKKLFSGTRNQIISNALETFNVKDR… |
| A0A4Z0JLS8 | 10-124 | CLKWLENNEKYTSLSSNLIQIDTPFLDPSRDYITIYVESSEHDMTLTDDGWTLDYLETHGLTFKKGSKETKMLELILKKFNLIKEDD… |
| A0A1V8QIE6 | 11-131 | None |
| A0A4R7RGQ2 | 6-143 | None |
| A0A2N1R8P4 | 19-141 | None |
| I7KNU8 | 15-131 | None |
| A0A2Z6I9L2 | 4-130 | None |
| A0A2G8TF91 | 45-166 | None |
| A0A508YSJ4 | 93-193 | None |
| A0A3D0Z1D8 | 4-123 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.