DPCstruct | MC24658
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 132 ± 21 aa |
| Standard deviation of domain lengths | 20.61 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 86.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 34.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18934 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3T4D2Y6 | 2-136 | SEPLIVGIRHHSPACARLVKSLIESQRPRYVLIEGPADFNDRVDELFLAHQLPVAIYSYCQYQDGAAPGRGAWTPFAEFSPEWQALQ… |
| J2HAK2 | 26-116 | GQVVYFPVRHHSPACAYHLQKTIEAYAPQIILIEGPDNSNHLIPILTDEQTKPPISIYYAYASGENKYVCYFPFLAYSPEYVALTEA… |
| A4YLI0 | 14-144 | None |
| A0A4Q2XR47 | 49-150 | None |
| A0A521U4N6 | 24-169 | None |
| A0A1V1P608 | 36-172 | None |
| A0A066Z0L2 | 12-139 | None |
| A0A376RYA1 | 1-136 | None |
| G6C3N7 | 12-141 | None |
| A0A6I1YKG1 | 18-135 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.